BLAST Results
BLASTP 2.2.28+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: test_aa_db 214 sequences; 49,279 total letters Query= Length=148 Score E Sequences producing significant alignments: (Bits) Value gi|6694212|gb|AAF25181.1|AF182353_1 (AF182353) NADH dehydrogena... 21.2 1.6 gi|6694284|gb|AAF25201.1|AF196839_1 (AF196839) coat protein [Pa... 19.6 5.9 > Query1 on gi|6694212|gb|AAF25181.1|AF182353_1 (AF182353) NADH dehydrogenase [Eremitis sp. Clark and Zhang 1343] Length=702 Score = 21.2 bits (43), Expect = 1.6, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (55%), Gaps = 0/33 (0%) Query 26 AATAGGSLLVLSGLILAGTVIALTVATPLFVIF 58 +A + +V +G+ L + L ++ PL +IF Sbjct 253 SALIHAAXMVAAGIFLLARLFPLFISLPLIMIF 285 > Query1 on gi|6694284|gb|AAF25201.1|AF196839_1 (AF196839) coat protein [Papaya ringspot virus] Length=292 Score = 19.6 bits (39), Expect = 5.9, Method: Compositional matrix adjust. Identities = 9/37 (24%), Positives = 17/37 (46%), Gaps = 0/37 (0%) Query 4 HQQQSQRPDLQPRSHQVVKAATAATAGGSLLVLSGLI 40 ++ S+ PD +H +KAA A + + G + Sbjct 229 YEVNSKTPDRAREAHMQMKAAALRNASRRMFGMDGSV 265 Lambda K H a alpha 0.323 0.134 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3545962 Database: test_aa_db Posted date: Jul 19, 2010 4:26 PM Number of letters in database: 49,279 Number of sequences in database: 214 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40